Lineage for d2go7c2 (2go7 C:1-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919696Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919774Protein Hypothetical protein SP2064 [142139] (1 species)
  7. 2919775Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142140] (1 PDB entry)
    Uniprot Q97NG6 3-206
  8. 2919778Domain d2go7c2: 2go7 C:1-204 [135436]
    Other proteins in same PDB: d2go7c3
    automated match to d2go7a1
    complexed with cl, mg

Details for d2go7c2

PDB Entry: 2go7 (more details), 2.1 Å

PDB Description: crystal structure of a hydrolase from haloacid dehalogenase-like family (sp_2064) from streptococcus pneumoniae tigr4 at 2.10 a resolution
PDB Compounds: (C:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d2go7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2go7c2 c.108.1.6 (C:1-204) Hypothetical protein SP2064 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mqktafiwdldgtlldsyeailsgieetfaqfsipydkekvrefifkysvqdllvrvaed
rnldvevlnqvraqslaeknaqvvlmpgarevlawadesgiqqfiythkgnnaftilkdl
gvesyfteiltsqsgfvrkpspeaatylldkyqlnsdntyyigdrtldvefaqnsgiqsi
nflestyegnhriqaladisrife

SCOPe Domain Coordinates for d2go7c2:

Click to download the PDB-style file with coordinates for d2go7c2.
(The format of our PDB-style files is described here.)

Timeline for d2go7c2: