SCOP 1.73: Domain d2go7a1: 2go7 A:3-206

Lineage for d2go7a1 (2go7 A:3-206)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (9 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Hypothetical protein SP2064 [142139] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [142140] (1 PDB entry)

8. Domain d2go7a1: 2go7 A:3-206 [135434]
   complexed with cl, mg

Details for d2go7a1

PDB Entry: 2go7, 2.1 Å

PDB Description: crystal structure of a hydrolase from haloacid dehalogenase-like family (sp_2064) from streptococcus pneumoniae tigr4 at 2.10 a resolution

PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOP Domain Sequences for d2go7a1:

Sequence; same for both SEQRES and ATOM records:

>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]}
ktafiwdldgtlldsyeailsgieetfaqfsipydkekvrefifkysvqdllvrvaedrn
ldvevlnqvraqslaeknaqvvlmpgarevlawadesgiqqfiythkgnnaftilkdlgv
esyfteiltsqsgfvrkpspeaatylldkyqlnsdntyyigdrtldvefaqnsgiqsinf
lestyegnhriqaladisrifetk

Timeline for d2go7a1:

• d2go7a1 is new in SCOP 1.73
  
• d2go7a1 appears in SCOP 1.75
  
• d2go7a1 appears in the current release, SCOPe 2.08