Lineage for d2go5w1 (2go5 W:326-434)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489361Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 1489362Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 1489363Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 1489391Protein SRP54M [47451] (1 species)
  7. 1489392Species Human (Homo sapiens) [TaxId:9606] [47452] (3 PDB entries)
  8. 1489396Domain d2go5w1: 2go5 W:326-434 [135433]
    Other proteins in same PDB: d2go511, d2go521, d2go5b1
    automatically matched to d1mfqc_
    protein/RNA complex

Details for d2go5w1

PDB Entry: 2go5 (more details), 7.4 Å

PDB Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex
PDB Compounds: (W:) Signal recognition particle 54 kDa protein (SRP54)

SCOPe Domain Sequences for d2go5w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2go5w1 a.36.1.1 (W:326-434) SRP54M {Human (Homo sapiens) [TaxId: 9606]}
qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkm

SCOPe Domain Coordinates for d2go5w1:

Click to download the PDB-style file with coordinates for d2go5w1.
(The format of our PDB-style files is described here.)

Timeline for d2go5w1: