SCOPe 2.02: Domain d2go5w1: 2go5 W:326-434

Lineage for d2go5w1 (2go5 W:326-434)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein SRP54M [47451] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47452] (3 PDB entries)

8. Domain d2go5w1: 2go5 W:326-434 [135433]
   Other proteins in same PDB: d2go511, d2go521, d2go5b1
   automatically matched to d1mfqc_
   protein/RNA complex

Details for d2go5w1

PDB Entry: 2go5, 7.4 Å

PDB Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex

PDB Compounds: (W:) Signal recognition particle 54 kDa protein (SRP54)

SCOPe Domain Sequences for d2go5w1:

Sequence; same for both SEQRES and ATOM records:

>d2go5w1 a.36.1.1 (W:326-434) SRP54M {Human (Homo sapiens) [TaxId: 9606]}
qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkm

Timeline for d2go5w1:

• d2go5w1 first appeared in SCOP 1.73
  
• d2go5w1 appears in SCOPe 2.01
  
• d2go5w1 appears in SCOPe 2.03
  
• d2go5w1 appears in the current release, SCOPe 2.08