![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.201: SRP19 [69694] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.201.1: SRP19 [69695] (1 family) ![]() |
![]() | Family d.201.1.1: SRP19 [69696] (1 protein) |
![]() | Protein SRP19 [69697] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries) |
![]() | Domain d2go5b1: 2go5 B:14-118 [135432] Other proteins in same PDB: d2go511, d2go521, d2go5w1 automatically matched to d1jida_ protein/RNA complex |
PDB Entry: 2go5 (more details), 7.4 Å
SCOPe Domain Sequences for d2go5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2go5b1 d.201.1.1 (B:14-118) SRP19 {Human (Homo sapiens) [TaxId: 9606]} rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr
Timeline for d2go5b1: