Lineage for d2go521 (2go5 2:63-269)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988464Protein Signal recognition particle receptor beta-subunit [89664] (2 species)
  7. 988467Species Mouse (Mus musculus) [TaxId:10090] [142224] (2 PDB entries)
    Uniprot P47758 63-269
  8. 988469Domain d2go521: 2go5 2:63-269 [135431]
    Other proteins in same PDB: d2go511, d2go5b1, d2go5w1
    automatically matched to 2FH5 B:63-269
    protein/RNA complex

Details for d2go521

PDB Entry: 2go5 (more details), 7.4 Å

PDB Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex
PDB Compounds: (2:) Signal recognition particle receptor beta subunit (SR b)

SCOPe Domain Sequences for d2go521:

Sequence, based on SEQRES records: (download)

>d2go521 c.37.1.8 (2:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
amaksakliqqqlekelntlrvtrsaapstldssstapaqlgkkgkefefsqlplkvefl
ecsakggrgdtgsadiqdlekwlakia

Sequence, based on observed residues (ATOM records): (download)

>d2go521 c.37.1.8 (2:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
amaksakliqqqlekelntlrvtrspaqlgkkgkefefsqlplkveflecsaksadiqdl
ekwlakia

SCOPe Domain Coordinates for d2go521:

Click to download the PDB-style file with coordinates for d2go521.
(The format of our PDB-style files is described here.)

Timeline for d2go521: