![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Signal recognition particle receptor beta-subunit [89664] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [142224] (2 PDB entries) Uniprot P47758 63-269 |
![]() | Domain d2go521: 2go5 2:63-269 [135431] Other proteins in same PDB: d2go511, d2go512, d2go5b1, d2go5w1 automatically matched to 2FH5 B:63-269 protein/RNA complex |
PDB Entry: 2go5 (more details), 7.4 Å
SCOPe Domain Sequences for d2go521:
Sequence, based on SEQRES records: (download)
>d2go521 c.37.1.8 (2:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi amaksakliqqqlekelntlrvtrsaapstldssstapaqlgkkgkefefsqlplkvefl ecsakggrgdtgsadiqdlekwlakia
>d2go521 c.37.1.8 (2:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi amaksakliqqqlekelntlrvtrspaqlgkkgkefefsqlplkveflecsaksadiqdl ekwlakia
Timeline for d2go521:
![]() Domains from other chains: (mouse over for more information) d2go511, d2go512, d2go5b1, d2go5w1 |