![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.4: SNARE-like [64356] (4 families) ![]() beta(2)-alpha-beta(3)-alpha(2) |
![]() | Family d.110.4.4: SRP alpha N-terminal domain-like [90019] (2 proteins) |
![]() | Protein Signal recognition particle receptor alpha subunit, N-terminal domain [143735] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143736] (2 PDB entries) Uniprot P08240 1-129 |
![]() | Domain d2go511: 2go5 1:1-129 [135430] Other proteins in same PDB: d2go521, d2go5b1, d2go5w1 automatically matched to 2FH5 A:1-129 protein/RNA complex |
PDB Entry: 2go5 (more details), 7.4 Å
SCOPe Domain Sequences for d2go511:
Sequence, based on SEQRES records: (download)
>d2go511 d.110.4.4 (1:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqerggnnsfthealtlkykldn qfelvfvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrl lreaeessk
>d2go511 d.110.4.4 (1:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqethealtlkykldnqfelvfv vgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrllreaees sk
Timeline for d2go511: