Lineage for d2go511 (2go5 1:1-129)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870911Superfamily d.110.4: SNARE-like [64356] (4 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 870934Family d.110.4.4: SRP alpha N-terminal domain-like [90019] (2 proteins)
  6. 870935Protein Signal recognition particle receptor alpha subunit, N-terminal domain [143735] (1 species)
  7. 870936Species Human (Homo sapiens) [TaxId:9606] [143736] (2 PDB entries)
    Uniprot P08240 1-129
  8. 870938Domain d2go511: 2go5 1:1-129 [135430]
    Other proteins in same PDB: d2go521, d2go5b1, d2go5w1
    automatically matched to 2FH5 A:1-129

Details for d2go511

PDB Entry: 2go5 (more details), 7.4 Å

PDB Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex
PDB Compounds: (1:) Signal recognition particle receptor alpha subunit (SR a)

SCOP Domain Sequences for d2go511:

Sequence, based on SEQRES records: (download)

>d2go511 d.110.4.4 (1:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqerggnnsfthealtlkykldn
qfelvfvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrl
lreaeessk

Sequence, based on observed residues (ATOM records): (download)

>d2go511 d.110.4.4 (1:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqethealtlkykldnqfelvfv
vgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrllreaees
sk

SCOP Domain Coordinates for d2go511:

Click to download the PDB-style file with coordinates for d2go511.
(The format of our PDB-style files is described here.)

Timeline for d2go511: