SCOP 1.73: Domain d2go511: 2go5 1:1-129

Lineage for d2go511 (2go5 1:1-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (4 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.4: SRP alpha N-terminal domain-like [90019] (2 proteins)

6. Protein Signal recognition particle receptor alpha subunit, N-terminal domain [143735] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143736] (2 PDB entries)

8. Domain d2go511: 2go5 1:1-129 [135430]
   Other proteins in same PDB: d2go521, d2go5b1, d2go5w1
   automatically matched to 2FH5 A:1-129

Details for d2go511

PDB Entry: 2go5, 7.4 Å

PDB Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex

PDB Compounds: (1:) Signal recognition particle receptor alpha subunit (SR a)

SCOP Domain Sequences for d2go511:

Sequence, based on SEQRES records:

>d2go511 d.110.4.4 (1:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqerggnnsfthealtlkykldn
qfelvfvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrl
lreaeessk

Sequence, based on observed residues (ATOM records):

>d2go511 d.110.4.4 (1:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqethealtlkykldnqfelvfv
vgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrllreaees
sk

Timeline for d2go511:

• d2go511 is new in SCOP 1.73
  
• d2go511 appears in SCOP 1.75
  
• d2go511 appears in the current release, SCOPe 2.08