Lineage for d2go4a2 (2go4 A:134-279)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016991Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1016992Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1017461Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 1017462Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 1017463Species Aquifex aeolicus [TaxId:63363] [89829] (11 PDB entries)
    Uniprot O67648 3-270
  8. 1017491Domain d2go4a2: 2go4 A:134-279 [135427]
    automatically matched to d1xxea2
    complexed with cl, tux, zn

Details for d2go4a2

PDB Entry: 2go4 (more details), 2.7 Å

PDB Description: crystal structure of aquifex aeolicus lpxc complexed with tu-514
PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d2go4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2go4a2 d.14.1.7 (A:134-279) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkq

SCOPe Domain Coordinates for d2go4a2:

Click to download the PDB-style file with coordinates for d2go4a2.
(The format of our PDB-style files is described here.)

Timeline for d2go4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2go4a1