Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein) duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site |
Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [89829] (11 PDB entries) Uniprot O67648 3-270 |
Domain d2go3a1: 2go3 A:3-133 [135422] automatically matched to d1xxea1 complexed with cl, gol, imd, myr, plm, zn; mutant |
PDB Entry: 2go3 (more details), 2 Å
SCOP Domain Sequences for d2go3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2go3a1 d.14.1.7 (A:3-133) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]} lektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstdl gfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnreid yfvve
Timeline for d2go3a1: