SCOP 1.75: Domain d2go3a1: 2go3 A:3-133

Lineage for d2go3a1 (2go3 A:3-133)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [89829] (11 PDB entries)
   Uniprot O67648 3-270

8. Domain d2go3a1: 2go3 A:3-133 [135422]
   automatically matched to d1xxea1
   complexed with cl, gol, imd, myr, plm, zn; mutant

Details for d2go3a1

PDB Entry: 2go3, 2 Å

PDB Description: crystal structure of aquifex aeolicus lpxc complexed with imidazole.

PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOP Domain Sequences for d2go3a1:

Sequence; same for both SEQRES and ATOM records:

>d2go3a1 d.14.1.7 (A:3-133) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
lektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstdl
gfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnreid
yfvve

Timeline for d2go3a1:

• d2go3a1 first appeared in SCOP 1.73
  
• d2go3a1 appears in SCOPe 2.01
  
• d2go3a1 appears in the current release, SCOPe 2.08