![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries) |
![]() | Domain d2go0a_: 2go0 A: [135421] automated match to d4mtha_ |
PDB Entry: 2go0 (more details)
SCOPe Domain Sequences for d2go0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2go0a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rcpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksigns ysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstaflrw kdyncnvrlpyvckftd
Timeline for d2go0a_: