Lineage for d2go0a_ (2go0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608582Domain d2go0a_: 2go0 A: [135421]
    automated match to d4mtha_

Details for d2go0a_

PDB Entry: 2go0 (more details)

PDB Description: nmr solution structure of human pancreatitis-associated protein
PDB Compounds: (A:) Regenerating islet-derived protein 3 alpha

SCOPe Domain Sequences for d2go0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2go0a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksigns
ysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstaflrw
kdyncnvrlpyvckftd

SCOPe Domain Coordinates for d2go0a_:

Click to download the PDB-style file with coordinates for d2go0a_.
(The format of our PDB-style files is described here.)

Timeline for d2go0a_: