SCOP 1.73: Domain d2go0a1: 2go0 A:1-137

Lineage for d2go0a1 (2go0 A:1-137)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Pancreatitis-associated protein 1 [103341] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103342] (2 PDB entries)

8. Domain d2go0a1: 2go0 A:1-137 [135421]
   automatically matched to d1uv0a_

Details for d2go0a1

PDB Entry: 2go0

PDB Description: nmr solution structure of human pancreatitis-associated protein

PDB Compounds: (A:) Regenerating islet-derived protein 3 alpha

SCOP Domain Sequences for d2go0a1:

Sequence; same for both SEQRES and ATOM records:

>d2go0a1 d.169.1.1 (A:1-137) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
rcpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksigns
ysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstaflrw
kdyncnvrlpyvckftd

Timeline for d2go0a1:

• d2go0a1 is new in SCOP 1.73
  
• d2go0a1 appears in SCOP 1.75
  
• d2go0a1 appears in the current release, SCOPe 2.08, called d2go0a_