SCOPe 2.05: Domain d2gnum_: 2gnu M:

Lineage for d2gnum_ (2gnu M:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (7 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)

8. Domain d2gnum_: 2gnu M: [135420]
   Other proteins in same PDB: d2gnuh1, d2gnuh2
   automated match to d1aijm_
   complexed with bcl, bph, cdl, cl, fe2, lda, u10

Details for d2gnum_

PDB Entry: 2gnu, 2.2 Å

PDB Description: The crystallization of reaction center from Rhodobacter sphaeroides occurs via a new route

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2gnum_:

Sequence; same for both SEQRES and ATOM records:

>d2gnum_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
eyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslf
sglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasff
mfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifs
hldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadr
gtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

Timeline for d2gnum_:

• d2gnum_ first appeared in SCOP 1.73, called d2gnum1
  
• d2gnum_ appears in SCOPe 2.04
  
• d2gnum_ appears in SCOPe 2.06
  
• d2gnum_ appears in the current release, SCOPe 2.08