Lineage for d2gntb_ (2gnt B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.1: Legume lectins [49900] (5 proteins) 
Protein automated matches [190035] (28 species)
not a true protein
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries) 
Domain d2gntb_: 2gnt B: [135418]
automated match to d1n3oa_
complexed with ca
Details for d2gntb_
PDB Entry: 2gnt (more details), 2.02 Å
PDB Description: edta treated p. angolensis lectin (pal) remetallized with calcium (1 hour treatment)
PDB Compounds: (B:) lectinSCOPe Domain Sequences for d2gntb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gntb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
SCOPe Domain Coordinates for d2gntb_:
Click to download the PDB-style file with coordinates for d2gntb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gntb_:
- d2gntb_ first appeared in SCOP 1.73, called d2gntb1
- d2gntb_ appears in SCOPe 2.07
View in 3D
