Lineage for d2gnta_ (2gnt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2049734Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2050278Protein automated matches [190035] (27 species)
    not a true protein
  7. 2050279Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. 2050302Domain d2gnta_: 2gnt A: [135417]
    automated match to d1n3oa_
    complexed with ca

Details for d2gnta_

PDB Entry: 2gnt (more details), 2.02 Å

PDB Description: edta treated p. angolensis lectin (pal) remetallized with calcium (1 hour treatment)
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2gnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnta_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

SCOPe Domain Coordinates for d2gnta_:

Click to download the PDB-style file with coordinates for d2gnta_.
(The format of our PDB-style files is described here.)

Timeline for d2gnta_: