Lineage for d2gnta1 (2gnt A:1-240)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663305Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries)
  8. 663332Domain d2gnta1: 2gnt A:1-240 [135417]
    automatically matched to d1q8oa_
    complexed with ca

Details for d2gnta1

PDB Entry: 2gnt (more details), 2.02 Å

PDB Description: edta treated p. angolensis lectin (pal) remetallized with calcium (1 hour treatment)
PDB Compounds: (A:) lectin

SCOP Domain Sequences for d2gnta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnta1 b.29.1.1 (A:1-240) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

SCOP Domain Coordinates for d2gnta1:

Click to download the PDB-style file with coordinates for d2gnta1.
(The format of our PDB-style files is described here.)

Timeline for d2gnta1: