Lineage for d2gnsa1 (2gns A:1-133)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346280Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2346316Domain d2gnsa1: 2gns A:1-133 [135416]
    automatically matched to d1cl5a_
    complexed with so4

Details for d2gnsa1

PDB Entry: 2gns (more details), 2.3 Å

PDB Description: Design of specific peptide inhibitors of phospholipase A2: Crystal structure of the complex formed between a group II phospholipase A2 and a designed pentapeptide Ala- Leu- Val- Tyr- Lys at 2.3 A resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2gnsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnsa1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d2gnsa1:

Click to download the PDB-style file with coordinates for d2gnsa1.
(The format of our PDB-style files is described here.)

Timeline for d2gnsa1: