Class a: All alpha proteins [46456] (258 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (35 species) |
Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries) |
Domain d2gnsa1: 2gns A:1-133 [135416] automatically matched to d1cl5a_ complexed with so4 |
PDB Entry: 2gns (more details), 2.3 Å
SCOP Domain Sequences for d2gnsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gnsa1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d2gnsa1: