SCOPe 2.02: Domain d2gnoa2: 2gno A:11-208

Lineage for d2gnoa2 (2gno A:11-208)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [142324] (1 PDB entry)
   Uniprot Q9WZM9 11-208

8. Domain d2gnoa2: 2gno A:11-208 [135415]
   Other proteins in same PDB: d2gnoa1
   complexed with etx, na, unl

Details for d2gnoa2

PDB Entry: 2gno, 2 Å

PDB Description: Crystal structure of a dna polymerase iii, gamma subunit-related protein (tm0771) from thermotoga maritima msb8 at 2.00 A resolution

PDB Compounds: (A:) DNA polymerase III, gamma subunit-related protein

SCOPe Domain Sequences for d2gnoa2:

Sequence; same for both SEQRES and ATOM records:

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}
dqletlkriieksegisilingedlsyprevslelpeyvekfppkasdvleidpegenig
iddirtikdflnyspelytrkyvivhdcermtqqaanaflkaleeppeyavivlntrrwh
yllptiksrvfrvvvnvpkefrdlvkekigdlweelpllerdfktaleayklgaeklsgl
meslkvletekllkkvls

Timeline for d2gnoa2:

• d2gnoa2 first appeared in SCOP 1.73
  
• d2gnoa2 appears in SCOPe 2.01
  
• d2gnoa2 appears in SCOPe 2.03
  
• d2gnoa2 appears in the current release, SCOPe 2.08