| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
| Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species) |
| Species Thermotoga maritima [TaxId:2336] [142324] (1 PDB entry) Uniprot Q9WZM9 11-208 |
| Domain d2gnoa2: 2gno A:11-208 [135415] Other proteins in same PDB: d2gnoa1 complexed with etx, na, unl |
PDB Entry: 2gno (more details), 2 Å
SCOPe Domain Sequences for d2gnoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}
dqletlkriieksegisilingedlsyprevslelpeyvekfppkasdvleidpegenig
iddirtikdflnyspelytrkyvivhdcermtqqaanaflkaleeppeyavivlntrrwh
yllptiksrvfrvvvnvpkefrdlvkekigdlweelpllerdfktaleayklgaeklsgl
meslkvletekllkkvls
Timeline for d2gnoa2: