SCOP 1.75: Domain d2gnoa1: 2gno A:209-306

Lineage for d2gnoa1 (2gno A:209-306)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein gamma subunit [63578] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [140678] (1 PDB entry)
   Uniprot Q9WZM9 209-306

8. Domain d2gnoa1: 2gno A:209-306 [135414]
   Other proteins in same PDB: d2gnoa2
   complexed with etx, na, unl

Details for d2gnoa1

PDB Entry: 2gno, 2 Å

PDB Description: Crystal structure of a dna polymerase iii, gamma subunit-related protein (tm0771) from thermotoga maritima msb8 at 2.00 A resolution

PDB Compounds: (A:) DNA polymerase III, gamma subunit-related protein

SCOP Domain Sequences for d2gnoa1:

Sequence; same for both SEQRES and ATOM records:

>d2gnoa1 a.80.1.1 (A:209-306) gamma subunit {Thermotoga maritima [TaxId: 2336]}
kglegylacrellerfskveskeffalfdqvtntitgkdaflliqrltriilhentwesv
edqksvsfldsilrvkianlnnkltlmnilaihrerkr

Timeline for d2gnoa1:

• d2gnoa1 first appeared in SCOP 1.73
  
• d2gnoa1 appears in SCOPe 2.01
  
• d2gnoa1 appears in the current release, SCOPe 2.08