Class a: All alpha proteins [46456] (290 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein gamma subunit [63578] (2 species) |
Species Thermotoga maritima [TaxId:2336] [140678] (1 PDB entry) Uniprot Q9WZM9 209-306 |
Domain d2gnoa1: 2gno A:209-306 [135414] Other proteins in same PDB: d2gnoa2 complexed with etx, na, unl |
PDB Entry: 2gno (more details), 2 Å
SCOPe Domain Sequences for d2gnoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gnoa1 a.80.1.1 (A:209-306) gamma subunit {Thermotoga maritima [TaxId: 2336]} kglegylacrellerfskveskeffalfdqvtntitgkdaflliqrltriilhentwesv edqksvsfldsilrvkianlnnkltlmnilaihrerkr
Timeline for d2gnoa1: