SCOPe 2.07: Domain d2gndb_: 2gnd B:

Lineage for d2gndb_ (2gnd B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)

8. Domain d2gndb_: 2gnd B: [135411]
   automated match to d1n3oa_
   complexed with ca, man, mma, mn

Details for d2gndb_

PDB Entry: 2gnd, 2.25 Å

PDB Description: one hour edta treatment, p. angolensis lectin

PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2gndb_:

Sequence; same for both SEQRES and ATOM records:

>d2gndb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

Timeline for d2gndb_:

• d2gndb_ first appeared in SCOP 1.73, called d2gndb1
  
• d2gndb_ appears in SCOPe 2.06
  
• d2gndb_ appears in the current release, SCOPe 2.08