Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries) |
Domain d2gnbb_: 2gnb B: [135409] automated match to d1n3oa_ complexed with man |
PDB Entry: 2gnb (more details), 2.27 Å
SCOPe Domain Sequences for d2gnbb_:
Sequence, based on SEQRES records: (download)
>d2gnbb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
>d2gnbb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts anqviavefdtfyphigidvnsirsvktvkwdrrdgqslnvlvtfnpstrnldvvatysd gtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
Timeline for d2gnbb_: