Class a: All alpha proteins [46456] (286 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
Protein Hypothetical protein Atu0492 [140971] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry) Uniprot Q8UI08 2-148 |
Domain d2gmyf_: 2gmy F: [135403] automated match to d2gmya1 |
PDB Entry: 2gmy (more details), 1.6 Å
SCOPe Domain Sequences for d2gmyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmyf_ a.152.1.3 (F:) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]} ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv kitvaigaintwnriavgfrsqhpvea
Timeline for d2gmyf_: