SCOP 1.73: Domain d2gmyf1: 2gmy F:2-148

Lineage for d2gmyf1 (2gmy F:2-148)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (2 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein Hypothetical protein Atu0492 [140971] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry)

8. Domain d2gmyf1: 2gmy F:2-148 [135403]
   automatically matched to 2GMY A:2-148

Details for d2gmyf1

PDB Entry: 2gmy, 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD

PDB Compounds: (F:) Hypothetical protein Atu0492

SCOP Domain Sequences for d2gmyf1:

Sequence; same for both SEQRES and ATOM records:

>d2gmyf1 a.152.1.3 (F:2-148) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]}
ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
kitvaigaintwnriavgfrsqhpvea

Timeline for d2gmyf1:

• d2gmyf1 is new in SCOP 1.73
  
• d2gmyf1 appears in SCOP 1.75
  
• d2gmyf1 appears in the current release, SCOPe 2.08, called d2gmyf_