SCOPe 2.07: Domain d2gmye_: 2gmy E:

Lineage for d2gmye_ (2gmy E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (6 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein Hypothetical protein Atu0492 [140971] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry)
   Uniprot Q8UI08 2-148

8. Domain d2gmye_: 2gmy E: [135402]
   automated match to d2gmya1

Details for d2gmye_

PDB Entry: 2gmy, 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD

PDB Compounds: (E:) Hypothetical protein Atu0492

SCOPe Domain Sequences for d2gmye_:

Sequence; same for both SEQRES and ATOM records:

>d2gmye_ a.152.1.3 (E:) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]}
ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
kitvaigaintwnriavgfrsqhpv

Timeline for d2gmye_:

• d2gmye_ first appeared in SCOP 1.73, called d2gmye1
  
• d2gmye_ appears in SCOPe 2.06
  
• d2gmye_ appears in the current release, SCOPe 2.08