Lineage for d2gmye1 (2gmy E:2-146)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650162Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 650163Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 650214Family a.152.1.3: Atu0492-like [140970] (2 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 650215Protein Hypothetical protein Atu0492 [140971] (1 species)
  7. 650216Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry)
  8. 650221Domain d2gmye1: 2gmy E:2-146 [135402]
    automatically matched to 2GMY A:2-148

Details for d2gmye1

PDB Entry: 2gmy (more details), 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD
PDB Compounds: (E:) Hypothetical protein Atu0492

SCOP Domain Sequences for d2gmye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmye1 a.152.1.3 (E:2-146) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]}
ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
kitvaigaintwnriavgfrsqhpv

SCOP Domain Coordinates for d2gmye1:

Click to download the PDB-style file with coordinates for d2gmye1.
(The format of our PDB-style files is described here.)

Timeline for d2gmye1: