![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
![]() | Protein Hypothetical protein Atu0492 [140971] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry) Uniprot Q8UI08 2-148 |
![]() | Domain d2gmye_: 2gmy E: [135402] automated match to d2gmya1 |
PDB Entry: 2gmy (more details), 1.6 Å
SCOPe Domain Sequences for d2gmye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmye_ a.152.1.3 (E:) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]} ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv kitvaigaintwnriavgfrsqhpv
Timeline for d2gmye_: