SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2gmyd_ (2gmy D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013445Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2013446Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2013502Family a.152.1.3: Atu0492-like [140970] (6 protein domains)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 2013503Protein Hypothetical protein Atu0492 [140971] (1 species)
  7. 2013504Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry)
    Uniprot Q8UI08 2-148
  8. 2013508Domain d2gmyd_: 2gmy D: [135401]
    automated match to d2gmya1

Details for d2gmyd_

PDB Entry: 2gmy (more details), 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD
PDB Compounds: (D:) Hypothetical protein Atu0492

SCOPe Domain Sequences for d2gmyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmyd_ a.152.1.3 (D:) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]}
ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
kitvaigaintwnriavgfrsqhpv

SCOPe Domain Coordinates for d2gmyd_:

Click to download the PDB-style file with coordinates for d2gmyd_.
(The format of our PDB-style files is described here.)

Timeline for d2gmyd_: