Lineage for d2gmyc_ (2gmy C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926643Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 926644Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 926700Family a.152.1.3: Atu0492-like [140970] (6 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 926701Protein Hypothetical protein Atu0492 [140971] (1 species)
  7. 926702Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry)
    Uniprot Q8UI08 2-148
  8. 926705Domain d2gmyc_: 2gmy C: [135400]
    automated match to d2gmya1

Details for d2gmyc_

PDB Entry: 2gmy (more details), 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD
PDB Compounds: (C:) Hypothetical protein Atu0492

SCOPe Domain Sequences for d2gmyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmyc_ a.152.1.3 (C:) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]}
ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
kitvaigaintwnriavgfrsqhpve

SCOPe Domain Coordinates for d2gmyc_:

Click to download the PDB-style file with coordinates for d2gmyc_.
(The format of our PDB-style files is described here.)

Timeline for d2gmyc_: