SCOPe 2.08: Domain d2gmyc_: 2gmy C:

Lineage for d2gmyc_ (2gmy C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (6 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein Hypothetical protein Atu0492 [140971] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry)
   Uniprot Q8UI08 2-148

8. Domain d2gmyc_: 2gmy C: [135400]
   automated match to d2gmya1

Details for d2gmyc_

PDB Entry: 2gmy, 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD

PDB Compounds: (C:) Hypothetical protein Atu0492

SCOPe Domain Sequences for d2gmyc_:

Sequence; same for both SEQRES and ATOM records:

>d2gmyc_ a.152.1.3 (C:) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]}
ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
kitvaigaintwnriavgfrsqhpve

Timeline for d2gmyc_:

• d2gmyc_ first appeared in SCOP 1.73, called d2gmyc1
  
• d2gmyc_ appears in SCOPe 2.07