Lineage for d2gmvb2 (2gmv B:10-259)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884249Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1884250Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 1884251Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 1884252Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 1884253Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries)
  8. 1884261Domain d2gmvb2: 2gmv B:10-259 [135397]
    Other proteins in same PDB: d2gmva1, d2gmvb1
    automated match to d1khba2
    complexed with mn, pep, un8

Details for d2gmvb2

PDB Entry: 2gmv (more details), 2.3 Å

PDB Description: pepck complex with a gtp-competitive inhibitor
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase, cytosolic

SCOPe Domain Sequences for d2gmvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmvb2 c.109.1.1 (B:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

SCOPe Domain Coordinates for d2gmvb2:

Click to download the PDB-style file with coordinates for d2gmvb2.
(The format of our PDB-style files is described here.)

Timeline for d2gmvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gmvb1