![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries) |
![]() | Domain d2gmvb2: 2gmv B:10-259 [135397] Other proteins in same PDB: d2gmva1, d2gmvb1 automated match to d1khba2 complexed with mn, pep, un8 |
PDB Entry: 2gmv (more details), 2.3 Å
SCOPe Domain Sequences for d2gmvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmvb2 c.109.1.1 (B:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr masrlakeeg
Timeline for d2gmvb2: