Lineage for d2gmva2 (2gmv A:10-259)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848369Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 848370Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 848371Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 848372Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (1 species)
  7. 848373Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries)
  8. 848380Domain d2gmva2: 2gmv A:10-259 [135395]
    Other proteins in same PDB: d2gmva1, d2gmvb1
    automatically matched to d1khba2
    complexed with mn, pep, un8

Details for d2gmva2

PDB Entry: 2gmv (more details), 2.3 Å

PDB Description: pepck complex with a gtp-competitive inhibitor
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic

SCOP Domain Sequences for d2gmva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmva2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

SCOP Domain Coordinates for d2gmva2:

Click to download the PDB-style file with coordinates for d2gmva2.
(The format of our PDB-style files is described here.)

Timeline for d2gmva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gmva1