Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries) Uniprot P02953 |
Domain d2gmrm_: 2gmr M: [135393] Other proteins in same PDB: d2gmrh1, d2gmrh2, d2gmrl1 automated match to d1ystm_ complexed with bcl, bph, fe2, lda, spn, u10; mutant |
PDB Entry: 2gmr (more details), 2.5 Å
SCOPe Domain Sequences for d2gmrm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} qnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsg lmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmf vavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshl dwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgt aaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
Timeline for d2gmrm_: