Lineage for d2gmpb_ (2gmp B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2373586Protein automated matches [190035] (28 species)
    not a true protein
  7. 2373587Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. 2373627Domain d2gmpb_: 2gmp B: [135392]
    automated match to d1n3oa_
    complexed with man, nag, so4

Details for d2gmpb_

PDB Entry: 2gmp (more details), 2.5 Å

PDB Description: metal-free (apo) p. angolensis seed lectin in complex with glcnac- beta(1-2)man
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2gmpb_:

Sequence, based on SEQRES records: (download)

>d2gmpb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

Sequence, based on observed residues (ATOM records): (download)

>d2gmpb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgnqviav
efdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpstrnldvva
tysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

SCOPe Domain Coordinates for d2gmpb_:

Click to download the PDB-style file with coordinates for d2gmpb_.
(The format of our PDB-style files is described here.)

Timeline for d2gmpb_: