| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
| Species Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId:4932] [64241] (2 PDB entries) |
| Domain d2gmib_: 2gmi B: [135381] Other proteins in same PDB: d2gmic_ automated match to d1jatb_ |
PDB Entry: 2gmi (more details), 2.5 Å
SCOPe Domain Sequences for d2gmib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmib_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]}
kvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriyslsi
dcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkemat
pankklrqpkegetf
Timeline for d2gmib_: