Lineage for d2gmib1 (2gmi B:3-137)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (4 families) 
Family d.20.1.1: UBC-related [54496] (6 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) 
Species Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId:4932] [64241] (2 PDB entries) 
Domain d2gmib1: 2gmi B:3-137 [135381]
Other proteins in same PDB: d2gmic1
automatically matched to d1jatb_
mutant
Details for d2gmib1
PDB Entry: 2gmi (more details), 2.5 Å
PDB Description: mms2/ubc13~ubiquitin
PDB Compounds: (B:) Ubiquitin-conjugating enzyme variant MMS2SCOP Domain Sequences for d2gmib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmib1 d.20.1.1 (B:3-137) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]}
kvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriyslsi
dcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkemat
pankklrqpkegetf
SCOP Domain Coordinates for d2gmib1:
Click to download the PDB-style file with coordinates for d2gmib1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gmib1:
- d2gmib1 is new in SCOP 1.73
- d2gmib1 appears in SCOP 1.75
- d2gmib1 appears in the current release, SCOPe 2.08, called d2gmib_
View in 3D
