SCOPe 2.08: Domain d2gmhb1: 2gmh B:7-236,B:336-482

Lineage for d2gmhb1 (2gmh B:7-236,B:336-482)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [141940] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [141941] (2 PDB entries)
   Uniprot P55931 27-259,359-505

8. Domain d2gmhb1: 2gmh B:7-236,B:336-482 [135378]
   Other proteins in same PDB: d2gmha2, d2gmha3, d2gmhb2, d2gmhb3
   automated match to d2gmha1
   complexed with bhg, edo, fad, na, sf4, uq5

Details for d2gmhb1

PDB Entry: 2gmh, 2.5 Å

PDB Description: structure of porcine electron transfer flavoprotein-ubiquinone oxidoreductase in complexed with ubiquinone

PDB Compounds: (B:) Electron transfer flavoprotein-ubiquinone oxidoreductase

SCOPe Domain Sequences for d2gmhb1:

Sequence; same for both SEQRES and ATOM records:

>d2gmhb1 c.3.1.2 (B:7-236,B:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
pritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaqhekdlr
vclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltekyripvp
ilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkgiatndv
giqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqXggfqsipkl
tfpgglligcspgfmnvpkikgthtamksgtlaaesifnqltsenlqsktiglhvteyed
nlknswvwkelysvrnirpschgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlk
pakdctpieypkpdgqis

Timeline for d2gmhb1:

• d2gmhb1 first appeared in SCOP 1.73
  
• d2gmhb1 appears in SCOPe 2.07