Lineage for d2gmhb1 (2gmh B:7-236,B:336-482)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096535Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [141940] (1 species)
  7. 2096536Species Pig (Sus scrofa) [TaxId:9823] [141941] (2 PDB entries)
    Uniprot P55931 27-259,359-505
  8. 2096538Domain d2gmhb1: 2gmh B:7-236,B:336-482 [135378]
    Other proteins in same PDB: d2gmha2, d2gmha3, d2gmhb2, d2gmhb3
    automated match to d2gmha1
    complexed with bhg, edo, fad, na, sf4, uq5

Details for d2gmhb1

PDB Entry: 2gmh (more details), 2.5 Å

PDB Description: Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase in Complexed with Ubiquinone
PDB Compounds: (B:) Electron transfer flavoprotein-ubiquinone oxidoreductase

SCOPe Domain Sequences for d2gmhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmhb1 c.3.1.2 (B:7-236,B:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
pritthytiyprdqdkrwegvnmerfaeeadvvivgagpaglsaatrlkqlaaqhekdlr
vclvekaahigahtlsgacldprafeelfpdwkekgaplntpvtedrfgiltekyripvp
ilpglpmnnhgnyvvrlghlvswmgeqaealgvevypgyaaaeilfhedgsvkgiatndv
giqkdgapkttferglelhakvtifaegchghlakqlykkfdlrancepqXggfqsipkl
tfpgglligcspgfmnvpkikgthtamksgtlaaesifnqltsenlqsktiglhvteyed
nlknswvwkelysvrnirpschgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlk
pakdctpieypkpdgqis

SCOPe Domain Coordinates for d2gmhb1:

Click to download the PDB-style file with coordinates for d2gmhb1.
(The format of our PDB-style files is described here.)

Timeline for d2gmhb1: