| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.8: Electron transfer flavoprotein-ubiquinone oxidoreductase-like [142988] (1 protein) |
| Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [142989] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [142990] (2 PDB entries) Uniprot P55931 260-358 |
| Domain d2gmha2: 2gmh A:237-335 [135376] Other proteins in same PDB: d2gmha1, d2gmha3, d2gmhb1, d2gmhb3 complexed with bhg, edo, fad, na, sf4, uq5 |
PDB Entry: 2gmh (more details), 2.5 Å
SCOPe Domain Sequences for d2gmha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
tygiglkelwvidekkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldy
qnpylspfrefqrwkhhpsikptleggkriaygaralne
Timeline for d2gmha2: