Lineage for d2gmea_ (2gme A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042740Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. 2042749Domain d2gmea_: 2gme A: [135373]
    automated match to d1n3oa_
    complexed with so4

Details for d2gmea_

PDB Entry: 2gme (more details), 1.75 Å

PDB Description: metal-free (apo) p. angolensis seed lectin
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2gmea_:

Sequence, based on SEQRES records: (download)

>d2gmea_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstlly

Sequence, based on observed residues (ATOM records): (download)

>d2gmea_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapnqviave
fdtfyntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpstrnldvvatysdg
tryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstlly

SCOPe Domain Coordinates for d2gmea_:

Click to download the PDB-style file with coordinates for d2gmea_.
(The format of our PDB-style files is described here.)

Timeline for d2gmea_: