Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries) |
Domain d2gmea_: 2gme A: [135373] automated match to d1n3oa_ complexed with so4 |
PDB Entry: 2gme (more details), 1.75 Å
SCOPe Domain Sequences for d2gmea_:
Sequence, based on SEQRES records: (download)
>d2gmea_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstlly
>d2gmea_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapnqviave fdtfyntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpstrnldvvatysdg tryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstlly
Timeline for d2gmea_: