SCOPe 2.08: Domain d2gm8c2: 2gm8 C:2-212

Lineage for d2gm8c2 (2gm8 C:2-212)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (9 species)
   not a true protein

7. Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries)

8. Domain d2gm8c2: 2gm8 C:2-212 [135370]
   Other proteins in same PDB: d2gm8a3, d2gm8b3, d2gm8c3, d2gm8d3
   automated match to d1udda_
   complexed with edo, hmh

Details for d2gm8c2

PDB Entry: 2gm8, 2.5 Å

PDB Description: tena homolog/thi-4 thiaminase complexed with product 4-amino-5- hydroxymethyl-2-methylpyrimidine

PDB Compounds: (C:) tenA homolog/Thi-4 Thiaminase

SCOPe Domain Sequences for d2gm8c2:

Sequence; same for both SEQRES and ATOM records:

>d2gm8c2 a.132.1.0 (C:2-212) automated matches {Pyrobaculum aerophilum [TaxId: 178306]}
vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra
psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal
egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld
ssglsaeelwpyfkeaslyelefwqaayegh

Timeline for d2gm8c2:

• d2gm8c2 first appeared in SCOP 1.73, called d2gm8c1
  
• d2gm8c2 appears in SCOPe 2.07