![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (9 species) not a true protein |
![]() | Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries) |
![]() | Domain d2gm8a2: 2gm8 A:2-212 [135368] Other proteins in same PDB: d2gm8a3, d2gm8b3, d2gm8c3, d2gm8d3 automated match to d1udda_ complexed with edo, hmh |
PDB Entry: 2gm8 (more details), 2.5 Å
SCOPe Domain Sequences for d2gm8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gm8a2 a.132.1.0 (A:2-212) automated matches {Pyrobaculum aerophilum [TaxId: 178306]} vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld ssglsaeelwpyfkeaslyelefwqaayegh
Timeline for d2gm8a2: