Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species) |
Species Escherichia coli [TaxId:562] [46732] (6 PDB entries) |
Domain d2gm4b1: 2gm4 B:141-183 [135362] Other proteins in same PDB: d2gm4a2, d2gm4b2 automatically matched to d1gdta1 protein/DNA complex |
PDB Entry: 2gm4 (more details), 3.5 Å
SCOPe Domain Sequences for d2gm4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gm4b1 a.4.1.2 (B:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} grkrkidrdavlnmwqqglgashisktmniarstvykvinesn
Timeline for d2gm4b1: