Lineage for d2gm4b1 (2gm4 B:141-183)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761328Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 761329Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)
  7. 761330Species Escherichia coli [TaxId:562] [46732] (6 PDB entries)
  8. 761338Domain d2gm4b1: 2gm4 B:141-183 [135362]
    Other proteins in same PDB: d2gm4a2, d2gm4b2
    automatically matched to d1gdta1
    mutant

Details for d2gm4b1

PDB Entry: 2gm4 (more details), 3.5 Å

PDB Description: an activated, tetrameric gamma-delta resolvase: hin chimaera bound to cleaved dna
PDB Compounds: (B:) transposon gamma-delta resolvase

SCOP Domain Sequences for d2gm4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm4b1 a.4.1.2 (B:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

SCOP Domain Coordinates for d2gm4b1:

Click to download the PDB-style file with coordinates for d2gm4b1.
(The format of our PDB-style files is described here.)

Timeline for d2gm4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gm4b2