Lineage for d2gm3f_ (2gm3 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861467Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2861491Protein Putative ethylene-responsive protein AT3g01520/F4P13_7 [142091] (1 species)
  7. 2861492Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142092] (1 PDB entry)
    Uniprot Q940U0 5-175
  8. 2861498Domain d2gm3f_: 2gm3 F: [135359]
    automated match to d2gm3a1
    complexed with amp

Details for d2gm3f_

PDB Entry: 2gm3 (more details), 2.46 Å

PDB Description: crystal structure of an universal stress protein family protein from arabidopsis thaliana at3g01520 with amp bound
PDB Compounds: (F:) unknown protein

SCOPe Domain Sequences for d2gm3f_:

Sequence, based on SEQRES records: (download)

>d2gm3f_ c.26.2.4 (F:) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedgfddv
dsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvr
pdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd

Sequence, based on observed residues (ATOM records): (download)

>d2gm3f_ c.26.2.4 (F:) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
rdmrqglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrglgtvs
afcvkhaecpvmtikrnadetpsdpadd

SCOPe Domain Coordinates for d2gm3f_:

Click to download the PDB-style file with coordinates for d2gm3f_.
(The format of our PDB-style files is described here.)

Timeline for d2gm3f_: