| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
| Protein Putative ethylene-responsive protein AT3g01520/F4P13_7 [142091] (1 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142092] (1 PDB entry) Uniprot Q940U0 5-175 |
| Domain d2gm3f_: 2gm3 F: [135359] automated match to d2gm3a1 complexed with amp |
PDB Entry: 2gm3 (more details), 2.46 Å
SCOPe Domain Sequences for d2gm3f_:
Sequence, based on SEQRES records: (download)
>d2gm3f_ c.26.2.4 (F:) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedgfddv
dsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvr
pdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
>d2gm3f_ c.26.2.4 (F:) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
rdmrqglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrglgtvs
afcvkhaecpvmtikrnadetpsdpadd
Timeline for d2gm3f_: