SCOPe 2.05: Domain d2gm3e_: 2gm3 E:

Lineage for d2gm3e_ (2gm3 E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein Putative ethylene-responsive protein AT3g01520/F4P13_7 [142091] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142092] (1 PDB entry)
   Uniprot Q940U0 5-175

8. Domain d2gm3e_: 2gm3 E: [135358]
   automated match to d2gm3a1
   complexed with amp

Details for d2gm3e_

PDB Entry: 2gm3, 2.46 Å

PDB Description: crystal structure of an universal stress protein family protein from arabidopsis thaliana at3g01520 with amp bound

PDB Compounds: (E:) unknown protein

SCOPe Domain Sequences for d2gm3e_:

Sequence, based on SEQRES records:

>d2gm3e_ c.26.2.4 (E:) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedgfddv
dsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvr
pdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd

Sequence, based on observed residues (ATOM records):

>d2gm3e_ c.26.2.4 (E:) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvsiyaspedf
rdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqevkrvrpdflvvgsrg
lgtvsafcvkhaecpvmtikrnadetpsdpadd

Timeline for d2gm3e_:

• d2gm3e_ first appeared in SCOP 1.73, called d2gm3e1
  
• d2gm3e_ appears in SCOPe 2.04
  
• d2gm3e_ appears in SCOPe 2.06
  
• d2gm3e_ appears in the current release, SCOPe 2.08